Protein coding transcript 11271

• Transcript: Ll_transcript_335317
• CDS coordinates: 114-1151 (+)
• Peptide sequence: MASSLLSIASHSLSSLSLQNNDKAKVGGNSLRFNKEGPNTFSNAKSSGRISMVAAVNVSRFEGIPMAPPDPILGVSEAFRADTSDAKLNLGVGAYRTEELQPYVLKVVNKAENLMLERGENKEYLAIEGLAAFNKATAELLLGADNPAIKEQRVATVQGLSGTGSLRLGAALIERYFPGAKVLISAPTWGNHKNIFNDAKVPWSEYRYYDPKTVGLDFEGMIEDIKAAPEGTFVLLHGCAHNPTGIDPTLEQWEKIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFVSRGLEVLVAQSYSKNLGLYAERIGAINVISSSPESAVRCVKFSIPCFLISEVE*
• ORF Type: complete

Annotations of Ll_transcript_335317

• Blastp: Aspartate aminotransferase P2, mitochondrial from Lupinus with 95.85% of identity
• Blastx: Aspartate aminotransferase P2, mitochondrial from Lupinus with 95.85% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438784.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;