Protein coding transcript 11293

• Transcript: Ll_transcript_335221
• CDS coordinates: 469-879 (+)
• Peptide sequence: MTSRCKGIVNDQFNELLSLENTRGPDYVVTSISTYIADVEMILSDISHHVENSKVDFSHMASLARAIEDKSASIGAEHMMLACSDLIKACDEKHKRKLIRSLPWTKSEFTQTKNKFMDLVRMEMRIIRFQSSQPSE*
• ORF Type: complete

Annotations of Ll_transcript_335221

• Blastp: Histidine-containing phosphotransfer protein 1 from Oryza sativa with 27.5% of identity
• Blastx: Histidine-containing phosphotransfer protein 1 from Oryza sativa with 27.5% of identity
• Eggnog: Histidine kinase(COG2198)
• Kegg: Link to kegg annotations (4346300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448060.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;