Protein coding transcript 112941

• Transcript: Ll_transcript_398052
• CDS coordinates: 463-903 (+)
• Peptide sequence: MPIAIDTDKAKSQHYELPTSFFKLVLGENLKYSSCYFSSPSKTLEEAEEAMLELYCERSKLKDGHTVLDIGCGWGSLPLYIAKKYSNSRVTGICNSTTQKAYIEERIRDLQLQNLDIIVADIRTFEMERSFDRIISIEMFEVGVCE*
• ORF Type: complete

Annotations of Ll_transcript_398052

• Blastp: (S)-coclaurine N-methyltransferase from Thalictrum with 53.19% of identity
• Blastx: (S)-coclaurine N-methyltransferase from Thalictrum with 50.15% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAU20766)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417540.1)
• Pfam: Mycolic acid cyclopropane synthetase (PF02353.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;