Protein coding transcript 112943

• Transcript: Ll_transcript_398054
• CDS coordinates: 112-750 (+)
• Peptide sequence: MEGIMQVPYQTTTKLMLASLERNLLPDPIIRRITRLLLASRLRSCAKPSSQLQLDDFIQFVHSLQEMPIAIDTDKAKSQHYELPTSFFKLVLGENLKYSSCYFSSPSKTLEEAEEAMLELYCERSKLKDGHTVLDIGCGWGSLPLYIAKKYSNSRVTGICNSTTQKAYIEERIRDLQLQNLDIIVADIRTFEMERSFDRIISIEMFEVGVCE*
• ORF Type: complete

Annotations of Ll_transcript_398054

• Blastp: (S)-coclaurine N-methyltransferase from Thalictrum with 47.54% of identity
• Blastx: (S)-coclaurine N-methyltransferase from Thalictrum with 48.97% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAU20766)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417540.1)
• Pfam: Mycolic acid cyclopropane synthetase (PF02353.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;