Transcript | Ll_transcript_399357 |
---|---|
CDS coordinates | 2524-3336 (+) |
Peptide sequence | MSAIRDLDLKVGTFRKMKNLRFLSFYLSCKTGYSTLRLPLGLHLFSDKLSYIQWDRYPSKSFPLKFCPKKLAMLLMPESCLRKLWDEVKDLQNLKIIDLNGSRRLKELPDFSLALNLEEIVLTGCERLCRIHSSIFSLHSLVVLNLDGCKKLKRLEGENLSEVLNLDLPSLEHLSLSRSNIESLPASIKQCTKLIDLGLEDCKKLQYLPELPQSIQDLYLGRSNIERLPTSIKQLPKLTKLFLTDCKKLQSLPLELPQFIKELALSGSNIE |
ORF Type | 3prime_partial |
Blastp | Disease resistance protein RML1A from Arabidopsis with 36.88% of identity |
---|---|
Blastx | TMV resistance protein N from Nicotiana with 39.79% of identity |
Eggnog | NB-ARC domain(ENOG410ZQRA) |
Kegg | Link to kegg annotations (AT1G64070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446056.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer