Protein coding transcript 113003

• Transcript: Ll_transcript_400026
• CDS coordinates: 463-1188 (+)
• Peptide sequence: MALQRRRHHHCHQRFRLMAPVISGIAAALLVLFSLLSLLAPSPNDTVYLHSHSSFNVEKSDAVRTPVFLVPSSGGKSDRHVWSSRNAEHFHGCSDANNKFLKAEAITKSNRYLGIATSGGLNQQRTGITDAVVAARILNATLVVPKLDQKSFWKDSSNFSEIFDVDWFISYLSKDVKIIKQLPRKGGKTLSAYSMRVPRKCNERCYINRILPVLMKKHSSPSLSLIVIHCLEDVTLKSTSH*
• ORF Type: complete

Annotations of Ll_transcript_400026

• Blastp: Uncharacterized protein At1g04910 from Arabidopsis with 46.28% of identity
• Blastx: Uncharacterized protein At1g04910 from Arabidopsis with 33.14% of identity
• Eggnog: DUF246 domain-containing protein(ENOG410Z25U)
• Kegg: Link to kegg annotations (AT1G04910)
• CantataDB: Link to cantataDB annotations (CNT0002173)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413239.1)
• Pfam: GDP-fucose protein O-fucosyltransferase (PF10250.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;