Protein coding transcript 11303

• Transcript: Ll_transcript_335567
• CDS coordinates: 391-1098 (+)
• Peptide sequence: MFTCISSKKQIAEEERNEGHESGSLRTSSKTLTAQVKDLALKVSRSLHLKGNTGSIPITKGNIQQRDETSSSEVEFSGFQRTTNEPSIPIGRVPGFHLTRPTSTSASEIVEMEEERFREWTIEVDDGVHMTFQSLPDGGNTILRIRFSHQKFNQLQAQRWWIDNYEQIIKSYNIRRSHQQNISITPPPTDHEVMEDHPLEEAQNPTLWDIQESPQSISFREWIKGMYSSNPDEGM*
• ORF Type: complete

Annotations of Ll_transcript_335567

• Blastp: Protein BREVIS RADIX from Arabidopsis with 35.02% of identity
• Blastx: Protein BREVIS RADIX from Arabidopsis with 35.02% of identity
• Eggnog: protein BREVIS RADIX-like(ENOG410YFJP)
• Kegg: Link to kegg annotations (AT1G31880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435937.1)
• Pfam: Transcription factor regulating root and shoot growth via Pin3 (PF08381.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;