Transcript | Ll_transcript_335571 |
---|---|
CDS coordinates | 68-652 (+) |
Peptide sequence | MFTCISSKKQIAEEERNEGHESGSLRTSSKTLTAQVKDLALKVSRSLHLKGNTGSIPITKGNIQQRDETSSSEVEFSGFQRTTNEPSIPIGRVPGFHLTRPTSTSASEIVEMEEERFREWTIEVDDGVHMTFQSLPDGGNTILRIRFSHQKFNQLQAQRWWIDNYEQIIKSYNIRRSHQQNISITPPPTDHEVT* |
ORF Type | complete |
Blastp | Protein BREVIS RADIX from Arabidopsis with 35.21% of identity |
---|---|
Blastx | Protein BREVIS RADIX from Arabidopsis with 35.21% of identity |
Eggnog | protein BREVIS RADIX-like(ENOG410YFJP) |
Kegg | Link to kegg annotations (AT1G31880) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435937.1) |
Pfam | Transcription factor regulating root and shoot growth via Pin3 (PF08381.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer