Protein coding transcript 113131

• Transcript: Ll_transcript_399014
• CDS coordinates: 3-569 (+)
• Peptide sequence: GVLIVYMIIIGDVLSGTSASGEHHSGIFEGWFGVHWWTGRTFIVLFTTLAIFAPLASFKRIDSLRFTSALSVALAVVFLVIAVGISIVKIISGGVAMPKLFPDVTDVASLLKLFTVVPVFVTAYICHFNGMLIIQTFVSSLFLLLKCFGVFMWGGVIELCYYMLICMKKCRGINLTISSESFIPIHAQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_399014

• Blastp: Amino acid transporter AVT6A from Arabidopsis with 73.64% of identity
• Blastx: Amino acid transporter AVT6B from Arabidopsis with 68.22% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT3G30390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420053.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;