Protein coding transcript 113138

• Transcript: Ll_transcript_399018
• CDS coordinates: 323-859 (+)
• Peptide sequence: MHSVVRTALTLCSSVYIMTSFFGFLLFGEGTLDDVLANFDTDLGIPFGSVLNDIVRFSYAAHLMLVFPVVFYPLRINIDGLIFSKSRPLVLDNFRFASITIALIGVIYLGANFIPSIWDAFQFTGATVAVCVGFIFPAAITLRDRYNLVTKQDKILSVIMIVLAIFSSVVAIYSDAFA*
• ORF Type: complete

Annotations of Ll_transcript_399018

• Blastp: Amino acid transporter AVT6B from Arabidopsis with 74.44% of identity
• Blastx: Amino acid transporter AVT6B from Arabidopsis with 74.11% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G38820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442767.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;