Transcript | Ll_transcript_397328 |
---|---|
CDS coordinates | 1440-3017 (+) |
Peptide sequence | MFNETFHPHVMEKSEPGSGVESSDDYTSAAHNLNSVDDHGSDQSCDEDDYSDLFSDDYMDVDDYASLQAHFDNVDIPPGIEAPIPWLAEYDLGSKKTGGSSLYPSGHIQSDPKNSCLTNLAQSPWSLEPTYPVSQGPSVGSSSLPIKMDSIDHPSEIELSSAQLFSQTVPSRKKLDAYQCRRRKFKFSLGESSKCHLHLGPSEGKKKHSVLDALNSHELIHNSETMKLYGGVTPYWGQSASAKKAGGSSGSHNSNFVGPEIGSLYPRAIEVTNPWWLKSPPYVKSFTNSNFFYHDNTWVHNGSTTDNTVVTISDEARDEILRKFTNFKQFDTAEDTSDHYFVHVDSSVKQHPKNWAKRIQEEWKSLEKDLPDSIFVRVYESRIDLLRAVIIGAEGTPYHDGLFFFDVFFPSGYPNVPPLVQYNSGGLRLNPNLYNCGKVCLSLLNTWSGSKNEKWLPGVSTILQVLVSIQGLILNAKPYFNEPGFARSNGSASGEMKSLRYNEDIFILSLRTMVYMIRNPPKVGF* |
ORF Type | complete |
Blastp | Probable ubiquitin-conjugating enzyme E2 25 from Arabidopsis with 68.78% of identity |
---|---|
Blastx | Probable ubiquitin-conjugating enzyme E2 25 from Arabidopsis with 68.78% of identity |
Eggnog | ubiquitin-conjugating enzyme(ENOG410XP8C) |
Kegg | Link to kegg annotations (AT3G15355) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413879.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer