Protein coding transcript 113196

• Transcript: Ll_transcript_397321
• CDS coordinates: 1450-1746 (+)
• Peptide sequence: MNLFPEQHPKNWAKKIQEEWKILEKDLPDTIFVRVYESRMDLLRAVIIGAEGTPYHDGLFFFDVFFPSAYPKVPPQVHYHSGGLRLNPNLHHCGKVCLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_397321

• Blastp: Probable ubiquitin-conjugating enzyme E2 25 from Arabidopsis with 28.76% of identity
• Blastx: Putative ubiquitin-conjugating enzyme E2 38 from Arabidopsis with 56.77% of identity
• Eggnog: ubiquitin-conjugating enzyme(ENOG410XP8C)
• Kegg: Link to kegg annotations (AT3G15355)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443954.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;