Transcript | Ll_transcript_335153 |
---|---|
CDS coordinates | 344-919 (+) |
Peptide sequence | MVVSSTNPHNKEIAIRRRIASIFNKREDDFTSLREYNDYLEEVEDMTFNLIEGIDVAAIEAKIAEYQEENAEQIMINRARKAEELAAALAASKGKPAQADNDVAANQNSHAEGVSGVPQGQYAPTFAGQPRPTGMAPQPLPLGGGGMPGYAADDEETMRLRAERGAAAGGWSPQISKKRALEEAFGTMWVC* |
ORF Type | complete |
Blastp | CDK-activating kinase assembly factor MAT1 from Xenopus with 28.34% of identity |
---|---|
Blastx | CDK-activating kinase assembly factor MAT1 from Mus with 50% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (380053) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445208.1) |
Pfam | CDK-activating kinase assembly factor MAT1 (PF06391.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer