Protein coding transcript 113405

• Transcript: Ll_transcript_397972
• CDS coordinates: 3-1196 (+)
• Peptide sequence: STTYTLTILSIFHAFALSSETSSRNNMIFPQLLCMMILACAYASLASGATLSEDEVEVMKDIGKTVGKKDWDFSVDPCSGEGNWTSFVQDKGFQNAVTCDCSFANGSLCHVVSIILKSQNLSGTLPSELVRLPFLQEIDVTRNYLNGTIPPQWGSMNLVNISLLGNRLTGSIPKELGNITTLKKLVLEFNQLSGNLPPELGNLPQLEMLLLTSNNFTGNLPATFAELTTLKHLRIGDNQFSGTIPNFIQSLTNLERLVMQGSGLSGPIPSGISLLENLNDLTISDLNGSDSPFPLLNNLTNLKKLVLRSCNIVGAVPGYLGNFTNLTVIDLSYNKLTGQIPMSFDGLNNLYMLVLSRNLLSGPLPTWIDKPDFVDLSYNNFSIKNIEQKQTCQQGSV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_397972

• Blastp: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 54.44% of identity
• Blastx: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 54.44% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443851.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;