Protein coding transcript 113415

• Transcript: Ll_transcript_397954
• CDS coordinates: 3-1589 (+)
• Peptide sequence: STTYTLTILSIFHAFALSSETSSRNNMIFPQLLCMMILACAYASLASGATLSEDEVEVMKDIGKTVGKKDWDFSVDPCSGEGNWTSFVQDKGFQNAVTCDCSFANGSLCHVVSIILKSQNLSGTLPSELVRLPFLQEIDVTRNYLNGTIPPQWGSMNLVNISLLGNRLTGSIPKELGNITTLKKLVLEFNQLSGNLPPELGNLPQLEMLLLTSNNFTGNLPATFAELTTLKHLRIGDNQFSGTIPNFIQSLTNLERLVMQGSGLSGPIPSGISLLENLNDLTISDLNGSDSPFPLLNNLTNLKKLVLRSCNIVGAVPGYLGNFTNLTVIDLSYNKLTGQIPMSFDGLNNLYMLVLSRNLLSGPLPTWIDKPDFVDLSYNNFSIKNIEQKQTCQQGSVNLFASSMDGNSLGNISCLANYHCPKTLYSLYINCGGRLVISNGSKTYDDDSSEMGPARFRQTGMNWAVITAGHFFDSGRSDYYTWSNTTKLLVDNAELYMDARVSPDTLTYYGFCLGNGNYTVNLHFAEIMF
• ORF Type: internal

Annotations of Ll_transcript_397954

• Blastp: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 51.4% of identity
• Blastx: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 51.4% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450582.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;