Protein coding transcript 113449

• Transcript: Ll_transcript_397913
• CDS coordinates: 148-474 (+)
• Peptide sequence: MLRLFSYDCFIQGCDASLLLDDSNSDKNGSSEKQAIPNQTSRGFDKIDMIKEELEQACPGVVSCADILALATRVVVLLVCFLYLYLYLFLSVMDLDNLSNYNLSCNVL*
• ORF Type: complete

Annotations of Ll_transcript_397913

• Blastp: Peroxidase 9 from Arabidopsis with 62.03% of identity
• Blastx: Putative Peroxidase 48 from Arabidopsis with 54.93% of identity
• Eggnog: peroxidase(ENOG410YFB5)
• Kegg: Link to kegg annotations (AT1G44970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443725.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;