Protein coding transcript 113470

• Transcript: Ll_transcript_397561
• CDS coordinates: 416-718 (+)
• Peptide sequence: MAYPGSMQLSRTSGFCNSHHNPMGVGRLHLVTVNLSPLSLNKQKQDSSALHLLSRVPPIRHVPSKCKIFVCRSVLIPGGGSVTPLLKSSAVILTRLASLP*
• ORF Type: complete

Annotations of Ll_transcript_397561

• Blastp: Mechanosensitive ion channel protein 3, chloroplastic from Arabidopsis with 40% of identity
• Blastx: Mechanosensitive ion channel protein 3, chloroplastic from Arabidopsis with 40% of identity
• Eggnog: Mechanosensitive ion channel(COG0668)
• Kegg: Link to kegg annotations (AT1G58200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417306.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;