Transcript | Ll_transcript_398976 |
---|---|
CDS coordinates | 434-790 (+) |
Peptide sequence | MVDVAEDSSFRFVLSPQPTPATLYLLKRCKWAAPEEIAELNQIEVCPQAMELTETIVNRISSDGGGALIIDYGFNGVISDSLQAIRKHKFVDLLDDPGSADLSAYVDFPSIRHSAEEAS |
ORF Type | 3prime_partial |
Blastp | Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial from Dictyostelium with 43.1% of identity |
---|---|
Blastx | Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial from Dictyostelium with 33.21% of identity |
Eggnog | NADH dehydrogenase ubiquinone complex I, assembly factor 7(COG1565) |
Kegg | Link to kegg annotations (DDB_G0282615) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454282.1) |
Pfam | Putative S-adenosyl-L-methionine-dependent methyltransferase (PF02636.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer