Protein coding transcript 113530

• Transcript: Ll_transcript_398992
• CDS coordinates: 3-599 (+)
• Peptide sequence: PMSMKTSEAMTLKDGDCKLFGISLRSSHDAQEPSALQRIGTSEPNGEMYLISHQQQNSENDQKSENLKSSRPSDGLVAADDHEKSKDVQAKLFSGSARSCTKVHKMGIALGRSVDLTKYSDYYGLIAELDRLFEFGGELMSANKDWLIVYTDNEGDMMLVGDDPWQEFCAIVRKIYIYPKEEIQKMSPGTLSSKYEDIQ
• ORF Type: internal

Annotations of Ll_transcript_398992

• Blastp: Auxin response factor 2B from Lycopersicon with 51.21% of identity
• Blastx: Auxin response factor 2B from Lycopersicon with 51.21% of identity
• Eggnog: auxin response factor(ENOG4110RNJ)
• Kegg: Link to kegg annotations (101249712)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430107.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;