Protein coding transcript 113548

• Transcript: Ll_transcript_397151
• CDS coordinates: 951-1283 (+)
• Peptide sequence: MKQSVGNPSVYCKLTLGNTPPRQTKVVSTGPNPEWDESFSWSFESPPKGQKLNISCKNKSKVGKSKFGKVTIQIDRVVMLGAVAGEYTLLPQSKSGPPRNLEIEFQWSNK*
• ORF Type: complete

Annotations of Ll_transcript_397151

• Blastp: Protein CELLULOSE SYNTHASE INTERACTIVE 1 from Arabidopsis with 90.91% of identity
• Blastx: Protein CELLULOSE SYNTHASE INTERACTIVE 1 from Arabidopsis with 91.21% of identity
• Eggnog: ARM(ENOG410ZTP2)
• Kegg: Link to kegg annotations (AT2G22125)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459406.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;