| Transcript | Ll_transcript_524243 |
|---|---|
| CDS coordinates | 3-332 (+) |
| Peptide sequence | AWSNFMIDCLAELVGDDLLATNIKRIRMGEEKNACNSLLLKINQIGTITEAIEAANEAYRAGWSVFVSHRSGETTDDFIADLTVALQTGHLKSGAPCRGERVAKYNRLMD |
| ORF Type | internal |
| Blastp | Enolase from Neocallimastix with 60.36% of identity |
|---|---|
| Blastx | Enolase from Neocallimastix with 60.36% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_006582042.1) |
| Pfam | Enolase, C-terminal TIM barrel domain (PF00113.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer