Transcript | Ll_transcript_397752 |
---|---|
CDS coordinates | 573-872 (+) |
Peptide sequence | MRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPDAKIEYRDNTEDDPHKRKPDISKAKEQLGWEPKVDLRKGLPLMVSDFRQRIFGDHKEGAAATFA* |
ORF Type | complete |
Blastp | UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 88.17% of identity |
---|---|
Blastx | UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 86.27% of identity |
Eggnog | Nad-dependent epimerase dehydratase(COG0451) |
Kegg | Link to kegg annotations (AT3G62830) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427927.1) |
Pfam | GDP-mannose 4,6 dehydratase (PF16363.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer