Protein coding transcript 11363

• Transcript: Ll_transcript_317232
• CDS coordinates: 2-472 (+)
• Peptide sequence: SSQRAAAVAALSQVLTAEKKKTSPDTSPVASTGPTAENSSFDAKHESPHSELEGPEEVAEAKETRETSPETGSNGDSELKQEKVEDENDGQNNQSVFSYEQLNTKSGSVVSGIDLKRRETYLSDEEFETIFKMTKEAFSKLPRWKQDMLKKKVDLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_317232

• Blastp: Villin-2 from Arabidopsis with 53.42% of identity
• Blastx: Villin-2 from Arabidopsis with 53.42% of identity
• Eggnog: capping protein (actin filament) gelsolin-like(ENOG410XR0A)
• Kegg: Link to kegg annotations (AT2G41740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434149.1)
• Pfam: Villin headpiece domain (PF02209.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;