| Transcript | Ll_transcript_524267 |
|---|---|
| CDS coordinates | 1-312 (+) |
| Peptide sequence | KEGISAPNLRPYRCHHYQKVEVEKLAAEMLEAGVIRPGISPYSSPIILVTKKDGGGDFVWTTGLSTSSQYLTSSLFQLLRNFWMNWGEPRSSLNWTSNQAIIK* |
| ORF Type | 5prime_partial |
| Blastp | Uncharacterized mitochondrial protein AtMg00850 from Arabidopsis with 53.66% of identity |
|---|---|
| Blastx | Retrovirus-related Pol polyprotein from transposon opus from Sophophora with 52.46% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (ArthMp074) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020997360.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer