| Transcript | Ll_transcript_397768 |
|---|---|
| CDS coordinates | 132-446 (+) |
| Peptide sequence | MGSMKVHQFTRGGFWEHEPLSLTLGCKRLRPLAPKLSNSNITTTIPFDLKSFIKPESGSTKLGSSYDDNKKDPPSPKDQVHYLLVFNLFFSMSIHAVIIHVHMI* |
| ORF Type | complete |
| Blastp | WUSCHEL-related homeobox 4 from Arabidopsis with 45.24% of identity |
|---|---|
| Blastx | WUSCHEL-related homeobox 4 from Arabidopsis with 67.62% of identity |
| Eggnog | homeobox(ENOG410YND1) |
| Kegg | Link to kegg annotations (AT1G46480) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447143.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer