Protein coding transcript 113851

• Transcript: Ll_transcript_398723
• CDS coordinates: 1168-1794 (+)
• Peptide sequence: MAVVYLVALTFLLFQKRDDARQFMKYLHPDLGVELPERSYGADCRIYLADNPTSRFKNVYETLFDEFVPAHIIGWWGKAILIRNQPLLWVLSIGFEMMELTFRHMLPNFNECWWDSIILDILICNWFGIWAGMHTVRYFDGKTYKWVGLSRQPNIIGKVSFNVYDCFLVSHNVGSFFSIEIEVTQTCMIDIFVYWVHNQCLIYDNCLN*
• ORF Type: complete

Annotations of Ll_transcript_398723

• Blastp: CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Oryza sativa with 88.75% of identity
• Blastx: CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Oryza sativa with 89.47% of identity
• Eggnog: Phosphatidylserine synthase(ENOG410XS7H)
• Kegg: Link to kegg annotations (4326076)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452433.1)
• Pfam: Phosphatidyl serine synthase (PF03034.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;