Protein coding transcript 113852

• Transcript: Ll_transcript_398724
• CDS coordinates: 3-500 (+)
• Peptide sequence: HESCSYNVSHYEKFCVFFLDSATLFQLSNLIPLFLTFSFEIDFSGTINMESNGHRRVKRPDYVKENGDFYLSNGDDEHDPWTAWAYKPHTITLLLIGACFLIWASGALDPERDASGDLVTTVKRGVWTMVAVFLAYCLLQAPSTVLIRPHPAIWRLVHGMAVVYLV
• ORF Type: internal

Annotations of Ll_transcript_398724

• Blastp: CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Arabidopsis with 71.67% of identity
• Blastx: CDP-diacylglycerol--serine O-phosphatidyltransferase 1 from Arabidopsis with 71.67% of identity
• Eggnog: Phosphatidylserine synthase(ENOG410XS7H)
• Kegg: Link to kegg annotations (AT1G15110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441437.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;