Protein coding transcript 11387

• Transcript: Ll_transcript_316917
• CDS coordinates: 119-820 (+)
• Peptide sequence: MDPHLPNSSKLLKEQFVSNLNGSSMLEIFALTTTMPILILIRHSITSNLFIGAYPKKKNDDAVSGNRNLKAYLATLSLDYLVIVVPMLLFFTVLADWSYITACLLLILTLLYIAAKRSGDSSLSFEGEPNSLRSYIMSYRIIVMIITFLCILAVDFKIFPRRYAKTETYGTSLMDLGVGAFVLANSLVSRQARNITSVNLKGTIISSSPLIILGFLRLVTTTSVDYQVRLYSL*
• ORF Type: complete

Annotations of Ll_transcript_316917

• Blastp: Uncharacterized protein At4g17910 from Arabidopsis with 57.39% of identity
• Blastx: Uncharacterized protein At4g17910 from Arabidopsis with 56.6% of identity
• Eggnog: Phosphatidylinositol glycan anchor biosynthesis, class W(COG5062)
• Kegg: Link to kegg annotations (AT4G17910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446999.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;