Protein coding transcript 113956

• Transcript: Ll_transcript_397104
• CDS coordinates: 40-576 (+)
• Peptide sequence: MASSFIKLDDSPMFQKQLFSLEEAADELKDRCQQLFKGCKKFMEALGEAYNGEVSFADSLEVFGSGQDDPVSLSVGGPVISKFITTLRELASFKELLRSQVEHMLIDRLTEFMTVDLQDVKDSRRRFDKAVHSYDQSREKFASLKKTTPGDVVIELEEVCLINLSMISSFLNLMQSLH*
• ORF Type: complete

Annotations of Ll_transcript_397104

• Blastp: ADP-ribosylation factor GTPase-activating protein AGD2 from Arabidopsis with 75% of identity
• Blastx: ADP-ribosylation factor GTPase-activating protein AGD2 from Arabidopsis with 75% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT1G60860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450951.1)
• Pfam: BAR domain of APPL family (PF16746.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;