Transcript | Ll_transcript_397086 |
---|---|
CDS coordinates | 40-372 (+) |
Peptide sequence | MASSFIKLDDSPMFQKQLFSLEEAADELKDRCQQLFKGCKKFMEALGEAYNGEVSFADSLEVFGSGQDDPVSLSVGGPVISKFITTLRELASFKELLRSQISCIGRAHVD* |
ORF Type | complete |
Blastp | ADP-ribosylation factor GTPase-activating protein AGD2 from Arabidopsis with 72% of identity |
---|---|
Blastx | ADP-ribosylation factor GTPase-activating protein AGD2 from Arabidopsis with 70.59% of identity |
Eggnog | domain, ankyrin repeat and PH domain(COG5347) |
Kegg | Link to kegg annotations (AT1G60860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450951.1) |
Pfam | BAR domain of APPL family (PF16746.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer