| Transcript | Ll_transcript_316988 |
|---|---|
| CDS coordinates | 2337-2657 (+) |
| Peptide sequence | MYSHLCRCSDLLLALMISGYFKIFLIAMTVWEFPSSVIFIIELFCLSSNAVALKVMTESTMSRCVCACFSAYAIKLFATQILDLTFWGKLIQGWSQTPSSFSLKPS* |
| ORF Type | complete |
| Blastp | Protein arv1 homolog from Dictyostelium with 34.43% of identity |
|---|---|
| Blastx | - |
| Eggnog | ARV1 homolog (S. cerevisiae)(COG5254) |
| Kegg | Link to kegg annotations (DDB_G0290221) |
| CantataDB | Link to cantataDB annotations (CNT0001977) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454676.1) |
| Pfam | Arv1-like family (PF04161.12) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer