Protein coding transcript 11404

• Transcript: Ll_transcript_316980
• CDS coordinates: 115-438 (+)
• Peptide sequence: MGYRCVQCSFPIKSLYVQYSPGNIRLMKCENCKAVADEYIECEIMILVIDLILHKPKAYRHLLYNVINQQTLMFQVYVIHGPCCTKIMFECCVLMCLSLTPNCFLQF*
• ORF Type: complete

Annotations of Ll_transcript_316980

• Blastp: Protein arv1 from Schizosaccharomyces with 47.14% of identity
• Blastx: Protein arv1 from Schizosaccharomyces with 46.48% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAPB1A10.15)
• CantataDB: Link to cantataDB annotations (CNT0001977)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454675.1)
• Pfam: Arv1-like family (PF04161.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;