Transcript | Ll_transcript_316985 |
---|---|
CDS coordinates | 115-426 (+) |
Peptide sequence | MGYRCVQCSFPIKSLYVQYSPGNIRLMKCENCKAVADEYIECEIMILVIDLILHKPKAYRHLLYNVINQQTLMFQGLFWKLAFVFLLFDSCIHFMSILLFLML* |
ORF Type | complete |
Blastp | Protein arv1 from Schizosaccharomyces with 47.14% of identity |
---|---|
Blastx | Protein arv1 from Schizosaccharomyces with 47.14% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAPB1A10.15) |
CantataDB | Link to cantataDB annotations (CNT0001977) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454675.1) |
Pfam | Arv1-like family (PF04161.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer