Protein coding transcript 114132

• Transcript: Ll_transcript_399687
• CDS coordinates: 54-701 (+)
• Peptide sequence: MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSSVVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL*
• ORF Type: complete

Annotations of Ll_transcript_399687

• Blastp: Cytochrome b6 from Eucalyptus with 99.07% of identity
• Blastx: Cytochrome b6 from Eucalyptus with 99.07% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: osa-MIR5523 (MI0019042)
• Ncbi protein: Link to NCBI protein (YP_008963631.1)
• Pfam: Cytochrome b/b6/petB (PF00033.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;