Protein coding transcript 1142

• Transcript: Ll_transcript_367398
• CDS coordinates: 2-394 (+)
• Peptide sequence: YTIGEDGLRRKIYRGMGSIDAMEDKKAGGATDKAGNTAKNAGTARYFSEGDKLLVAQGVSGSVLDRGSITKFIPYLSAGVQHSLQDIGCKSIEELQEGVKSGEVRFEYRTASAQLEGGIQGFAGSVEKKLY
• ORF Type: internal

Annotations of Ll_transcript_367398

• Blastp: Inosine-5'-monophosphate dehydrogenase from Aspergillus with 64.12% of identity
• Blastx: Inosine-5'-monophosphate dehydrogenase from Aspergillus with 64.12% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AFUA_2G03610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020963350.1)
• Pfam: IMP dehydrogenase / GMP reductase domain (PF00478.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;