Protein coding transcript 114205

• Transcript: Ll_transcript_398897
• CDS coordinates: 209-1045 (+)
• Peptide sequence: MDLSSGQNQQIMSSQSLEKMLASSNSQQERKPRSEPEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCKRYWTKGGTLRNVPVGGGCRKAKRSLKKAQDQTFTPTHNPNPLNTFPHLTYGHDSSDPLTLGFQKQSWDQLCFDHHDVSTLGNPTSSLCNILGNQGMNPSTTNNGLLDSLRSGFLGTQNNNGQNTYYVYGNGDMDDGKSGMMMVAYDEEMSNVGSEAMRVCGKKEEESGNRVLGGFPWQLNMGEVDSGITSWNGFTSSWHGLLHSPLI*
• ORF Type: complete

Annotations of Ll_transcript_398897

• Blastp: Dof zinc finger protein DOF2.1 from Arabidopsis with 40.82% of identity
• Blastx: Dof zinc finger protein DOF2.1 from Arabidopsis with 38.19% of identity
• Eggnog: zinc finger protein(ENOG410YM1Y)
• Kegg: Link to kegg annotations (AT2G28510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457809.1)
• Pfam: Dof domain, zinc finger (PF02701.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;