Transcript | Ll_transcript_399895 |
---|---|
CDS coordinates | 325-783 (+) |
Peptide sequence | MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREVLYDKSADGKTYVTGLSLSKATAKKIVKADAYVAACDVPGIKRLLPSEWRQHQFFNNIYELVGVPVITVQLRYNGWVTELQ |
ORF Type | 3prime_partial |
Blastp | Zeta-carotene desaturase, chloroplastic/chromoplastic from Arabidopsis with 88.24% of identity |
---|---|
Blastx | Zeta-carotene desaturase, chloroplastic/chromoplastic from Arabidopsis with 88.44% of identity |
Eggnog | Desaturase(COG3349) |
Kegg | Link to kegg annotations (AT3G04870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453327.1) |
Pfam | Flavin containing amine oxidoreductase (PF01593.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer