Protein coding transcript 114221

• Transcript: Ll_transcript_399884
• CDS coordinates: 1-1128 (+)
• Peptide sequence: LNHLISNKLMVKMMSKSKKTYKFDNRNVSLALSAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSFIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGANNNLLVKDHTHTFVNKGGQVGELDFRFLVGAPLHGIRAFLTTNQLKTYDKARNALALALSPVVRALVDPDGALQDIRNLDGVSFSDWFLSKGGTRASIQRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREILYGNSADGSTFVTGLSMSKATDKKIVKADAYVAACDVPGIKRLLPSEWRQHQFFNNIYELVGVPVVTVQLRYNGWVTELQ
• ORF Type: internal

Annotations of Ll_transcript_399884

• Blastp: Zeta-carotene desaturase, chloroplastic/chromoplastic from Narcissus with 85.59% of identity
• Blastx: Zeta-carotene desaturase, chloroplastic/chromoplastic from Narcissus with 85.59% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439955.1)
• Pfam: NAD(P)-binding Rossmann-like domain (PF13450.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;