Transcript | Ll_transcript_399887 |
---|---|
CDS coordinates | 1-1149 (+) |
Peptide sequence | LNHLISNKLMVKMMSKSKKTYKFDNRNVSLALSAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSIIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGAHNNLLVKDHTHTFVNKGGEIGELDFRFLVGAPLHGIKAFLTTNQLKTYDKARNAVALALSPVVRALVDPDGALRDIRNLDSISFSDWFLSKGGTRPSIKRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREILYGNSADGSTYVTGLSMSQATDKKIVKADAYVAAIDIPGIKKLLPSEWRQHQFFDNIYELVGVPVVTVQLRYNGWVTELQDLEMSR* |
ORF Type | 5prime_partial |
Blastp | Zeta-carotene desaturase, chloroplastic/chromoplastic from Tagetes with 86.35% of identity |
---|---|
Blastx | Zeta-carotene desaturase, chloroplastic/chromoplastic from Tagetes with 78.48% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428565.1) |
Pfam | NAD(P)-binding Rossmann-like domain (PF13450.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer