Protein coding transcript 114291

• Transcript: Ll_transcript_398854
• CDS coordinates: 1112-1570 (+)
• Peptide sequence: MGFLAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYLAGLPLVQQYLSQFEQLVREHLPKLGEHFSQEMINPSMYASQWFITVFSYSFPFHLALRIWDVFLYEVSSTSPYKNPWCKILMAVGIYSAIKVWLLLLYIYIDNVFVVPGCENCL*
• ORF Type: complete

Annotations of Ll_transcript_398854

• Blastp: USP6 N-terminal-like protein from Mus with 40.38% of identity
• Blastx: USP6 N-terminal-like protein from Mus with 40.43% of identity
• Eggnog: TBC1 domain family member(COG5210)
• Kegg: Link to kegg annotations (98910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004507259.1)
• Pfam: Rab-GTPase-TBC domain (PF00566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;