Protein coding transcript 114297

• Transcript: Ll_transcript_398860
• CDS coordinates: 3-659 (+)
• Peptide sequence: DISRTFPSHVFFRQRHGPGQRSLYNVLKAYSVFDRNVGYVQGMGFLAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYLAGLPLVQQYLSQFEQLVKEHLPKLGEHFSQEMINPSMYASQWFITVFSYSFPFHLALRIWDVFLYEGVKIVFKVGLALLMYCHDDLIKLPFEKLLHALKKFPEDAMNPDTILPLAYSIKVLFLSTHFGSDTARCFHIL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_398860

• Blastp: Ecotropic viral integration site 5 protein homolog from Homo with 41.79% of identity
• Blastx: Ecotropic viral integration site 5 protein homolog from Homo with 42.79% of identity
• Eggnog: ecotropic viral integration site(ENOG410YWJY)
• Kegg: Link to kegg annotations (7813)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419899.1)
• Pfam: Rab-GTPase-TBC domain (PF00566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;