Protein coding transcript 1143

• Transcript: Ll_transcript_367405
• CDS coordinates: 2-343 (+)
• Peptide sequence: SLVDNPVANKENYRYWILFLVPQIRFLDYQKVKDTERVKAREIFGTLKAPTEAAQSILAASANASTSYIAPLANGASKQPKVKLNEKEKARFEALIKNAKSLAEITRLEKDMSE
• ORF Type: internal

Annotations of Ll_transcript_367405

• Blastp: U2 small nuclear ribonucleoprotein A' from Aspergillus with 49.15% of identity
• Blastx: U2 small nuclear ribonucleoprotein A' from Aspergillus with 47.46% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AFUA_5G11000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452506.1)
• Pfam: Leucine-rich repeat (PF14580.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;