Protein coding transcript 114347

• Transcript: Ll_transcript_399484
• CDS coordinates: 190-990 (+)
• Peptide sequence: MSISVPTRQLFIDGEWKAPLLNKRIPIINPSTQQIIGDIPAATKEDVDLAVAAAKSALSRNKGADWASASGSVRARYLRAIAAKITEKKTELGKLESLDCGKPLDEALWDVDDVAGCFDYYADLAENLDKKQKSPVSLPLETFRSYVLKEPIGVVGLITPWNYPMLMATWKVAPALAAGCAAILKPSELASVTCLELAEICREVGLPRGVLNILTGLGPEAGAPLASHPDVDKITFTGSNATGSKIMTAAAQLVKVFLSSITANYV*
• ORF Type: complete

Annotations of Ll_transcript_399484

• Blastp: Betaine aldehyde dehydrogenase 1, chloroplastic from Arabidopsis with 79.22% of identity
• Blastx: Betaine aldehyde dehydrogenase 1 from Oryza sativa with 58.73% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT1G74920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017419700.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;