Transcript | Ll_transcript_399459 |
---|---|
CDS coordinates | 101-739 (+) |
Peptide sequence | MDTFRSYVLKEPIGVVGLITPWNYPLLMATWKVAPALAAGCVAILKPSELASVTCLELAEICREVGLPRGVLNILTGLGPEAGAPLASHPDVDKITFTGSNATGSKIMTAAAQLVKPVSLELGGKSPIVIFEDVDLDKAAEWALFGCFWVNGQICSATSRLIVHESIATEFLNRLVKWAKNIKISDPFEEGCRLGPVISEGQVHFQLFTCIY* |
ORF Type | complete |
Blastp | Betaine aldehyde dehydrogenase, chloroplastic from Amaranthus with 85.29% of identity |
---|---|
Blastx | Betaine aldehyde dehydrogenase 1, chloroplastic from Arabidopsis with 82.98% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463492.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer