Protein coding transcript 114353

• Transcript: Ll_transcript_399459
• CDS coordinates: 101-739 (+)
• Peptide sequence: MDTFRSYVLKEPIGVVGLITPWNYPLLMATWKVAPALAAGCVAILKPSELASVTCLELAEICREVGLPRGVLNILTGLGPEAGAPLASHPDVDKITFTGSNATGSKIMTAAAQLVKPVSLELGGKSPIVIFEDVDLDKAAEWALFGCFWVNGQICSATSRLIVHESIATEFLNRLVKWAKNIKISDPFEEGCRLGPVISEGQVHFQLFTCIY*
• ORF Type: complete

Annotations of Ll_transcript_399459

• Blastp: Betaine aldehyde dehydrogenase, chloroplastic from Amaranthus with 85.29% of identity
• Blastx: Betaine aldehyde dehydrogenase 1, chloroplastic from Arabidopsis with 82.98% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463492.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;