Transcript | Ll_transcript_399467 |
---|---|
CDS coordinates | 101-922 (+) |
Peptide sequence | MDTFRSYVLKEPIGVVGLITPWNYPLLMATWKVAPALAAGCVAILKPSELASVTCLELAEICREVGLPRGVLNILTGLGPEAGAPLASHTDVDKIAFTGSSATGSKIMTAAAQLIKPVSLELGGKSPIVVFEDVDLDKAAEWTLFGCFWTNGQICSATSRLIVHESIATEFLNKLVKWAKNIKISDPFEEGCRLGPVVSEGQYEKILKFISNAKSEGATILTGGSRPEHLKKGFFIEPTIISDVTTSMQIWREEVFGPVLCVKTFSTEEEAIDL |
ORF Type | 3prime_partial |
Blastp | Betaine aldehyde dehydrogenase, chloroplastic from Amaranthus with 85.4% of identity |
---|---|
Blastx | Betaine aldehyde dehydrogenase 1, chloroplastic from Arabidopsis with 85.02% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464328.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer