Protein coding transcript 114440

• Transcript: Ll_transcript_398147
• CDS coordinates: 2081-2854 (+)
• Peptide sequence: MTFYCFMQEVHSPFAFIRVPKVYTHLSRKRVLTMEWMVGESPTDLLSLSTGNSIGDVSEYSDKQKVAAKMRLLDMVNKGVEATLVQLLETGLLHADPHAGNLRYTPSGQIGFLDFGLLCQMEKKHQIAMLASIIHIVNGDWASLVRALIDMDVVRPGTNIRLVTLELELALGEVEFKEGIPDVKFSRVLGKIWSVAFKHHFRMPPYYTLVLRSLASFEGLAIAADKNFKTFEAAYPYVVRKLLTENSAGTRNILHSAL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_398147

• Blastp: Protein ACTIVITY OF BC1 COMPLEX KINASE 3, chloroplastic from Arabidopsis with 30.65% of identity
• Blastx: Uncharacterized protein sll0005 from Synechocystis with 32.84% of identity
• Eggnog: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661)
• Kegg: Link to kegg annotations (AT1G79600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020235143.1)
• Pfam: Phosphotransferase enzyme family (PF01636.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;