Transcript | Ll_transcript_398153 |
---|---|
CDS coordinates | 731-1270 (+) |
Peptide sequence | MPLSGFHGVISGFLVGIKQIIPDQELPLIKIKTKWLPSIAILLCVAISFWRLEAAAYLPTIISGTYISWIYLRYWQTKPETKLRGDPSEDFAFSTFFPEFLRPVIDPIASIFHRILCGRSDASNDAHGYTLGSEALPGSDSIEASRRRERGARALEERLAAERLAAARSELQRDASENV* |
ORF Type | complete |
Blastp | Rhomboid-like protein 19 from Arabidopsis with 69.61% of identity |
---|---|
Blastx | Rhomboid-like protein 19 from Arabidopsis with 69.72% of identity |
Eggnog | Transmembrane protein 115(ENOG410XQM0) |
Kegg | Link to kegg annotations (AT3G07950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414103.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer