Protein coding transcript 114450

• Transcript: Ll_transcript_398155
• CDS coordinates: 574-1113 (+)
• Peptide sequence: MPLSGFHGVISGFLVGIKQIIPDQELPLLKIKTKWLPSIAILLCIAISFWTLEAAAYLPTIISGTYISWIYLRYWQTKPETKHRGDPSEDFAFSTFFPEILRPVIDPIASIFHRLLCGRSDVSDDAQSYALGSEPLPGSDSIEASRRRERGARALEERLAAERLAAARSELQRDASENV*
• ORF Type: complete

Annotations of Ll_transcript_398155

• Blastp: Rhomboid-like protein 19 from Arabidopsis with 70.17% of identity
• Blastx: Rhomboid-like protein 19 from Arabidopsis with 72.73% of identity
• Eggnog: Transmembrane protein 115(ENOG410XQM0)
• Kegg: Link to kegg annotations (AT3G07950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459317.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;