Protein coding transcript 114453

• Transcript: Ll_transcript_398165
• CDS coordinates: 574-1113 (+)
• Peptide sequence: MPLSGFHGVISGFLVGIKQIIPDQELPLIKIKTKWLPSIAILLCVAISFWRLEAAAYLPTIISGTYISWIYLRYWQTKPETKLRGDPSEDFAFSTFFPEFLRPVIDPIASIFHRILCGRSDASNDAHGYTLGSEALPGSDSIEASRRRERGARALEERLAAERLAAARSELQRDASENV*
• ORF Type: complete

Annotations of Ll_transcript_398165

• Blastp: Rhomboid-like protein 19 from Arabidopsis with 69.61% of identity
• Blastx: Rhomboid-like protein 19 from Arabidopsis with 72.27% of identity
• Eggnog: Transmembrane protein 115(ENOG410XQM0)
• Kegg: Link to kegg annotations (AT3G07950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414103.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;