Protein coding transcript 1145

• Transcript: Ll_transcript_395978
• CDS coordinates: 304-915 (+)
• Peptide sequence: MEINMDEEPLNNIEERIRRLEGVIFRARQRQRWRQSHTPNQITNFAGELITTANVQDDGRVRREEVGIDAEAGTAGCGKIGKRKATFLIANALKTETYTSKAQGCGGSLFDCNICLGMARDPVLTCCGHLFCWPCFSQLSYAYLEAKECPVCKGEVTETGVTPIYGNGGANNSDQLGLEATGFRVPSRPRARRVESVRQYLRN*
• ORF Type: complete

Annotations of Ll_transcript_395978

• Blastp: E3 ubiquitin-protein ligase RMA2 from Arabidopsis with 44.33% of identity
• Blastx: E3 ubiquitin-protein ligase RMA2 from Arabidopsis with 44.33% of identity
• Eggnog: Ring finger protein(ENOG4111IHV)
• Kegg: Link to kegg annotations (AT4G28270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425558.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;